Lineage for d2onea2 (2one A:1-141)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602896Protein Enolase [54828] (6 species)
  7. 602897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries)
  8. 602903Domain d2onea2: 2one A:1-141 [38847]
    Other proteins in same PDB: d2onea1, d2oneb1

Details for d2onea2

PDB Entry: 2one (more details), 2 Å

PDB Description: asymmetric yeast enolase dimer complexed with resolved 2'-phosphoglycerate and phosphoenolpyruvate

SCOP Domain Sequences for d2onea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onea2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d2onea2:

Click to download the PDB-style file with coordinates for d2onea2.
(The format of our PDB-style files is described here.)

Timeline for d2onea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2onea1