Lineage for d2onea2 (2one A:1-141)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79862Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 79863Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 79864Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 79896Protein Enolase [54828] (2 species)
  7. 79897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (11 PDB entries)
  8. 79901Domain d2onea2: 2one A:1-141 [38847]
    Other proteins in same PDB: d2onea1, d2oneb1

Details for d2onea2

PDB Entry: 2one (more details), 2 Å

PDB Description: asymmetric yeast enolase dimer complexed with resolved 2'-phosphoglycerate and phosphoenolpyruvate
PDB Compounds: (A:)

SCOP Domain Sequences for d2onea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onea2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d2onea2:

Click to download the PDB-style file with coordinates for d2onea2.
(The format of our PDB-style files is described here.)

Timeline for d2onea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2onea1