Lineage for d4enl_2 (4enl 1-141)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32233Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 32234Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 32235Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 32261Protein Enolase [54828] (2 species)
  7. 32262Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (11 PDB entries)
  8. 32265Domain d4enl_2: 4enl 1-141 [38846]
    Other proteins in same PDB: d4enl_1

Details for d4enl_2

PDB Entry: 4enl (more details), 1.9 Å

PDB Description: crystal structure of holoenzyme refined at 1.9 angstroms resolution: trigonal-bipyramidal geometry of the cation binding site

SCOP Domain Sequences for d4enl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4enl_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d4enl_2:

Click to download the PDB-style file with coordinates for d4enl_2.
(The format of our PDB-style files is described here.)

Timeline for d4enl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4enl_1