Lineage for d1onea2 (1one A:1-141)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32233Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 32234Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 32235Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 32261Protein Enolase [54828] (2 species)
  7. 32262Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (11 PDB entries)
  8. 32263Domain d1onea2: 1one A:1-141 [38844]
    Other proteins in same PDB: d1onea1, d1oneb1

Details for d1onea2

PDB Entry: 1one (more details), 1.8 Å

PDB Description: yeast enolase complexed with an equilibrium mixture of 2'-phosphoglyceate and phosphoenolpyruvate

SCOP Domain Sequences for d1onea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onea2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d1onea2:

Click to download the PDB-style file with coordinates for d1onea2.
(The format of our PDB-style files is described here.)

Timeline for d1onea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1onea1