SCOP 1.61: Domain d1hnxc2: 1hnx C:107-207

Lineage for d1hnxc2 (1hnx C:107-207)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (10 PDB entries)

8. Domain d1hnxc2: 1hnx C:107-207 [38843]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxc2

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxc2:

Sequence; same for both SEQRES and ATOM records:

>d1hnxc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1hnxc2:

• d1hnxc2 first appeared (with stable ids) in SCOP 1.55
  
• d1hnxc2 appears in SCOP 1.59
  
• d1hnxc2 appears in SCOP 1.63
  
• d1hnxc2 appears in the current release, SCOPe 2.08