Lineage for d1hnxc2 (1hnx C:107-207)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79847Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
  4. 79848Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 79849Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 79850Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 79851Species Thermus thermophilus [TaxId:274] [54824] (10 PDB entries)
  8. 79858Domain d1hnxc2: 1hnx C:107-207 [38843]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxc2

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1hnxc2:

Click to download the PDB-style file with coordinates for d1hnxc2.
(The format of our PDB-style files is described here.)

Timeline for d1hnxc2: