Lineage for d6z9fg_ (6z9f G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2701140Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (46 PDB entries)
  8. 2701249Domain d6z9fg_: 6z9f G: [388426]
    automated match to d2fhaa_
    complexed with na

Details for d6z9fg_

PDB Entry: 6z9f (more details), 1.56 Å

PDB Description: 1.56 a structure of human apoferritin obtained from data subset of titan mono-bcor microscope
PDB Compounds: (G:) ferritin heavy chain

SCOPe Domain Sequences for d6z9fg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z9fg_ a.25.1.1 (G:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatd
kndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d6z9fg_:

Click to download the PDB-style file with coordinates for d6z9fg_.
(The format of our PDB-style files is described here.)

Timeline for d6z9fg_: