SCOPe 2.07: Domain d6x5pb_: 6x5p B:

Lineage for d6x5pb_ (6x5p B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries)

8. Domain d6x5pb_: 6x5p B: [388424]
   Other proteins in same PDB: d6x5pa_
   automated match to d2wphe_
   complexed with cit, gol, uqd

Details for d6x5pb_

PDB Entry: 6x5p, 2 Å

PDB Description: discovery of hydroxy pyrimidine factor ixa inhibitors

PDB Compounds: (B:) coagulation factor ix

SCOPe Domain Sequences for d6x5pb_:

Sequence, based on SEQRES records:

>d6x5pb_ g.3.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsq

Sequence, based on observed residues (ATOM records):

>d6x5pb_ g.3.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtcnikngrceqfcknvvcsctegyrlaenqkscepavpfpcgrvsvsq

Timeline for d6x5pb_:

• d6x5pb_ is new in SCOPe 2.07-stable
  
• d6x5pb_ appears in the current release, SCOPe 2.08