Lineage for d1hnzc2 (1hnz C:107-207)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904893Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1904894Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 1904895Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1904896Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1904922Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 1904935Domain d1hnzc2: 1hnz C:107-207 [38841]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnzc2

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1hnzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1hnzc2:

Click to download the PDB-style file with coordinates for d1hnzc2.
(The format of our PDB-style files is described here.)

Timeline for d1hnzc2: