Lineage for d1hr0c2 (1hr0 C:107-207)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411555Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 411556Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 411557Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 411558Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 411559Species Thermus thermophilus [TaxId:274] [54824] (14 PDB entries)
  8. 411561Domain d1hr0c2: 1hr0 C:107-207 [38840]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0c2

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1hr0c2:

Click to download the PDB-style file with coordinates for d1hr0c2.
(The format of our PDB-style files is described here.)

Timeline for d1hr0c2: