SCOP 1.59: Domain d1hr0c2: 1hr0 C:107-207

Lineage for d1hr0c2 (1hr0 C:107-207)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (10 PDB entries)

8. Domain d1hr0c2: 1hr0 C:107-207 [38840]
   Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0c2

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0c2:

Sequence; same for both SEQRES and ATOM records:

>d1hr0c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1hr0c2:

• d1hr0c2 first appeared (with stable ids) in SCOP 1.55
  
• d1hr0c2 appears in SCOP 1.57
  
• d1hr0c2 appears in SCOP 1.61
  
• d1hr0c2 appears in the current release, SCOPe 2.08