Lineage for d6x5lb_ (6x5l B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636414Protein automated matches [190092] (2 species)
    not a true protein
  7. 2636415Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries)
  8. 2636487Domain d6x5lb_: 6x5l B: [388390]
    Other proteins in same PDB: d6x5la_
    automated match to d2wphe_
    complexed with cit, gol, na, uqg

Details for d6x5lb_

PDB Entry: 6x5l (more details), 2.25 Å

PDB Description: discovery of hydroxy pyrimidine factor ixa inhibitors
PDB Compounds: (B:) coagulation factor ix

SCOPe Domain Sequences for d6x5lb_:

Sequence, based on SEQRES records: (download)

>d6x5lb_ g.3.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsq

Sequence, based on observed residues (ATOM records): (download)

>d6x5lb_ g.3.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtcnikngrceqfcknvvcsctegyrlaenqkscepavpfpcgrvsvsq

SCOPe Domain Coordinates for d6x5lb_:

Click to download the PDB-style file with coordinates for d6x5lb_.
(The format of our PDB-style files is described here.)

Timeline for d6x5lb_: