![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein automated matches [190092] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries) |
![]() | Domain d6x5lb_: 6x5l B: [388390] Other proteins in same PDB: d6x5la_ automated match to d2wphe_ complexed with cit, gol, na, uqg |
PDB Entry: 6x5l (more details), 2.25 Å
SCOPe Domain Sequences for d6x5lb_:
Sequence, based on SEQRES records: (download)
>d6x5lb_ g.3.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsq
>d6x5lb_ g.3.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtcnikngrceqfcknvvcsctegyrlaenqkscepavpfpcgrvsvsq
Timeline for d6x5lb_: