Lineage for d1fjgc2 (1fjg C:107-207)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32222Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
  4. 32223Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 32224Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 32225Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 32226Species Thermus thermophilus [TaxId:274] [54824] (6 PDB entries)
  8. 32228Domain d1fjgc2: 1fjg C:107-207 [38839]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgc2

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1fjgc2:

Click to download the PDB-style file with coordinates for d1fjgc2.
(The format of our PDB-style files is described here.)

Timeline for d1fjgc2: