Lineage for d6xdkd_ (6xdk D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897975Species Stenotrophomonas maltophilia [TaxId:522373] [383489] (3 PDB entries)
  8. 2897979Domain d6xdkd_: 6xdk D: [388383]
    automated match to d3qbob_
    complexed with ca, cl, edo, plp

Details for d6xdkd_

PDB Entry: 6xdk (more details), 1.6 Å

PDB Description: crystal structure of phosphoserine aminotransferase (serc) from stenotrophomonas maltophilia k279a
PDB Compounds: (D:) phosphoserine aminotransferase

SCOPe Domain Sequences for d6xdkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xdkd_ c.67.1.0 (D:) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
rafnfsagpatlpesvlrqaqaemldwhgsgasivemshrgaefmsvaaeaeadlrrlld
ipddyavlflsggattqqaliplnfaapgqradyvvsghwgktavkqagvyvdvniaass
eangyrelparadwqlsrdaayvhitanetihgvefrdvpdtgnvpliadfsssiasepl
dvrrygviyagaqknlgpvgvavmiirrdllersgqpradifdyrshvardsmlntpptw
nwylaglvfkwmlaeggvtefakrnaakaalvygaidgsggfyrnevayaarsrmnipff
lpdaeldarfvaeakaagllalkghkvvggiraslynamplagaealvafmadfqqrhg

SCOPe Domain Coordinates for d6xdkd_:

Click to download the PDB-style file with coordinates for d6xdkd_.
(The format of our PDB-style files is described here.)

Timeline for d6xdkd_: