Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Hypericum perforatum [TaxId:65561] [189103] (3 PDB entries) |
Domain d6sjjz_: 6sjj Z: [388381] Other proteins in same PDB: d6sjjc2, d6sjje2, d6sjjg2, d6sjjh2, d6sjji2, d6sjjj2, d6sjjk2, d6sjjl2, d6sjjm2, d6sjjn2, d6sjjo2, d6sjjq2, d6sjjr2, d6sjjs2, d6sjjt2 automated match to d5mmua_ complexed with 2an, dms, epe, flc, so4 |
PDB Entry: 6sjj (more details), 2.3 Å
SCOPe Domain Sequences for d6sjjz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sjjz_ d.129.3.0 (Z:) automated matches {Hypericum perforatum [TaxId: 65561]} maaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitfv dghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvty hpkpgctvneeevkigekkayefykqveeylaanpevfa
Timeline for d6sjjz_:
View in 3D Domains from other chains: (mouse over for more information) d6sjja_, d6sjjb_, d6sjjc1, d6sjjc2, d6sjjd_, d6sjje1, d6sjje2, d6sjjf_, d6sjjg1, d6sjjg2, d6sjjh1, d6sjjh2, d6sjji1, d6sjji2, d6sjjj1, d6sjjj2, d6sjjk1, d6sjjk2, d6sjjl1, d6sjjl2, d6sjjm1, d6sjjm2, d6sjjn1, d6sjjn2, d6sjjo1, d6sjjo2, d6sjjp_, d6sjjq1, d6sjjq2, d6sjjr1, d6sjjr2, d6sjjs1, d6sjjs2, d6sjjt1, d6sjjt2, d6sjju_, d6sjjv_, d6sjjw_, d6sjjx_, d6sjjy_ |