Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein GTPase Era C-terminal domain [54818] (2 species) |
Species Escherichia coli [TaxId:562] [54819] (3 PDB entries) |
Domain d1egab2: 1ega B:183-296 [38837] Other proteins in same PDB: d1egaa1, d1egab1 complexed with so4 |
PDB Entry: 1ega (more details), 2.4 Å
SCOP Domain Sequences for d1egab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egab2 d.52.3.1 (B:183-296) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg
Timeline for d1egab2: