![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein GTPase Era C-terminal domain [54818] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54819] (2 PDB entries) |
![]() | Domain d1egaa2: 1ega A:183-295 [38836] Other proteins in same PDB: d1egaa1, d1egab1 complexed with so4 |
PDB Entry: 1ega (more details), 2.4 Å
SCOPe Domain Sequences for d1egaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl
Timeline for d1egaa2: