Lineage for d6z6uw_ (6z6u W:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314153Protein (Apo)ferritin [47246] (8 species)
  7. 2314454Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (7 PDB entries)
  8. 2314496Domain d6z6uw_: 6z6u W: [388351]
    automated match to d2fhaa_

Details for d6z6uw_

PDB Entry: 6z6u (more details), 1.25 Å

PDB Description: 1.25 a structure of human apoferritin obtained from titan mono-bcor microscope
PDB Compounds: (W:) ferritin heavy chain

SCOPe Domain Sequences for d6z6uw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z6uw_ a.25.1.1 (W:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatd
kndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d6z6uw_:

Click to download the PDB-style file with coordinates for d6z6uw_.
(The format of our PDB-style files is described here.)

Timeline for d6z6uw_: