![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54817] (14 PDB entries) |
![]() | Domain d1hnwc1: 1hnw C:2-106 [38834] Other proteins in same PDB: d1hnwb_, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_ complexed with mg, tac, zn |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1hnwc1: