| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies) |
Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) ![]() |
| Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins) |
| Protein Ribosomal protein S3 N-terminal domain [54816] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries) |
| Domain d1hnzc1: 1hnz C:2-106 [38833] Other proteins in same PDB: d1hnzb_, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1hnzc1: