![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies) |
![]() | Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) ![]() |
![]() | Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries) |
![]() | Domain d1hr0c1: 1hr0 C:2-106 [38832] Other proteins in same PDB: d1hr0b_, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOP Domain Sequences for d1hr0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1hr0c1: