SCOP 1.57: Domain d1hr0c1: 1hr0 C:2-106

Lineage for d1hr0c1 (1hr0 C:2-106)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)

4. Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family)

5. Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries)

8. Domain d1hr0c1: 1hr0 C:2-106 [38832]
   Other proteins in same PDB: d1hr0b_, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0c1

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0c1:

Sequence; same for both SEQRES and ATOM records:

>d1hr0c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d1hr0c1:

• d1hr0c1 first appeared (with stable ids) in SCOP 1.55
  
• d1hr0c1 appears in SCOP 1.59
  
• d1hr0c1 appears in the current release, SCOPe 2.08