Lineage for d6w5fb_ (6w5f B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014317Species Bacillus subtilis [TaxId:224308] [278114] (4 PDB entries)
  8. 3014324Domain d6w5fb_: 6w5f B: [388316]
    automated match to d2iwca_
    complexed with edo, mli, peg; mutant

Details for d6w5fb_

PDB Entry: 6w5f (more details), 1.5 Å

PDB Description: class d beta-lactamase bsu-2 delta mutant
PDB Compounds: (B:) BSU-2delta mutant

SCOPe Domain Sequences for d6w5fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w5fb_ e.3.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
khlnvskmnvddefkdtdgtfilhdlqkdqtfvynrkranqrqtpqstfkvvnaliglqv
kavrdeydvkrwdgvkrefeswnrdhtlgsamresaiwyyqalardigeermktwlhtls
ygnedisggidqfwlqssltispleqetfleklakeelpfdkpvmkivkrmmiqeegdhy
tlygktgtdmglgwfvgfiktehgsyvfvtnvddsgtkaknitvdilkkyglits

SCOPe Domain Coordinates for d6w5fb_:

Click to download the PDB-style file with coordinates for d6w5fb_.
(The format of our PDB-style files is described here.)

Timeline for d6w5fb_: