SCOP 1.73: Domain d1fjgc1: 1fjg C:2-106

Lineage for d1fjgc1 (1fjg C:2-106)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)

8. Domain d1fjgc1: 1fjg C:2-106 [38831]
   Other proteins in same PDB: d1fjgb_, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
   complexed with mg, par, scm, sry, zn

Details for d1fjgc1

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1fjgc1:

Sequence; same for both SEQRES and ATOM records:

>d1fjgc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d1fjgc1:

• d1fjgc1 first appeared (with stable ids) in SCOP 1.55
  
• d1fjgc1 appears in SCOP 1.71
  
• d1fjgc1 appears in SCOP 1.75
  
• d1fjgc1 appears in the current release, SCOPe 2.08