![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies) |
![]() | Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) ![]() |
![]() | Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54817] (6 PDB entries) |
![]() | Domain d1fjgc1: 1fjg C:2-106 [38831] Other proteins in same PDB: d1fjgb_, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_ |
PDB Entry: 1fjg (more details), 3 Å
SCOP Domain Sequences for d1fjgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjgc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1fjgc1: