Lineage for d1gpmc3 (1gpm C:405-525)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191674Fold d.52: Alpha-lytic protease prodomain-like [54805] (4 superfamilies)
  4. 191693Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (1 family) (S)
  5. 191694Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein)
  6. 191695Protein GMP synthetase C-terminal dimerisation domain [54812] (1 species)
  7. 191696Species Escherichia coli [TaxId:562] [54813] (1 PDB entry)
  8. 191699Domain d1gpmc3: 1gpm C:405-525 [38828]
    Other proteins in same PDB: d1gpma1, d1gpma2, d1gpmb1, d1gpmb2, d1gpmc1, d1gpmc2, d1gpmd1, d1gpmd2

Details for d1gpmc3

PDB Entry: 1gpm (more details), 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate

SCOP Domain Sequences for d1gpmc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpmc3 d.52.2.1 (C:405-525) GMP synthetase C-terminal dimerisation domain {Escherichia coli}
gpglgvrvlgevkkeycdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgr
kydwvvslravetidfmtahwahlpydflgrvsnriinevngisrvvydisgkppatiew
e

SCOP Domain Coordinates for d1gpmc3:

Click to download the PDB-style file with coordinates for d1gpmc3.
(The format of our PDB-style files is described here.)

Timeline for d1gpmc3: