Lineage for d6ug0a_ (6ug0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519730Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2519806Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2519807Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 2519808Species Azotobacter vinelandii [TaxId:354] [81398] (30 PDB entries)
  8. 2519833Domain d6ug0a_: 6ug0 A: [388275]
    Other proteins in same PDB: d6ug0b_, d6ug0d_
    automated match to d1g20a_
    complexed with 1cl, fe, gol, h2s, hca, hdz, ice, icz, mo, pge

Details for d6ug0a_

PDB Entry: 6ug0 (more details), 1.83 Å

PDB Description: n2-bound nitrogenase mofe-protein from azotobacter vinelandii
PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d6ug0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ug0a_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]}
sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d6ug0a_:

Click to download the PDB-style file with coordinates for d6ug0a_.
(The format of our PDB-style files is described here.)

Timeline for d6ug0a_: