Lineage for d6sjjs1 (6sjj S:1-159)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582555Species Hypericum perforatum [TaxId:65561] [189103] (3 PDB entries)
  8. 2582576Domain d6sjjs1: 6sjj S:1-159 [388266]
    Other proteins in same PDB: d6sjjc2, d6sjje2, d6sjjg2, d6sjjh2, d6sjji2, d6sjjj2, d6sjjk2, d6sjjl2, d6sjjm2, d6sjjn2, d6sjjo2, d6sjjq2, d6sjjr2, d6sjjs2, d6sjjt2
    automated match to d5mmua_
    complexed with 2an, dms, epe, flc, so4

Details for d6sjjs1

PDB Entry: 6sjj (more details), 2.3 Å

PDB Description: a new modulated crystal structure of ans complex of st john's wort hyp-1 protein with 36 protein molecules in the asymmetric unit of the supercell
PDB Compounds: (S:) PR-10 protein

SCOPe Domain Sequences for d6sjjs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sjjs1 d.129.3.0 (S:1-159) automated matches {Hypericum perforatum [TaxId: 65561]}
maaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitfv
dghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvty
hpkpgctvneeevkigekkayefykqveeylaanpevfa

SCOPe Domain Coordinates for d6sjjs1:

Click to download the PDB-style file with coordinates for d6sjjs1.
(The format of our PDB-style files is described here.)

Timeline for d6sjjs1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6sjjs2