![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (4 superfamilies) |
![]() | Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (1 family) ![]() |
![]() | Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein) |
![]() | Protein GMP synthetase C-terminal dimerisation domain [54812] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54813] (1 PDB entry) |
![]() | Domain d1gpma3: 1gpm A:405-525 [38826] Other proteins in same PDB: d1gpma1, d1gpma2, d1gpmb1, d1gpmb2, d1gpmc1, d1gpmc2, d1gpmd1, d1gpmd2 |
PDB Entry: 1gpm (more details), 2.2 Å
SCOP Domain Sequences for d1gpma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpma3 d.52.2.1 (A:405-525) GMP synthetase C-terminal dimerisation domain {Escherichia coli} gpglgvrvlgevkkeycdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgr kydwvvslravetidfmtahwahlpydflgrvsnriinevngisrvvydisgkppatiew e
Timeline for d1gpma3: