SCOPe 2.05: Domain d2proc1: 2pro C:18-85

Lineage for d2proc1 (2pro C:18-85)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family)
   automatically mapped to Pfam PF02983

5. Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)

6. Protein Alpha-lytic protease prodomain [54808] (1 species)
   duplication: consists of two domains of this fold

7. Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)

8. Domain d2proc1: 2pro C:18-85 [38824]

Details for d2proc1

PDB Entry: 2pro, 3 Å

PDB Description: pro region of alpha-lytic protease

PDB Compounds: (C:) alpha-lytic protease

SCOPe Domain Sequences for d2proc1:

Sequence; same for both SEQRES and ATOM records:

>d2proc1 d.52.1.1 (C:18-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
ifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklvaatsgarksstlg
gvevrnvr

Timeline for d2proc1:

• d2proc1 first appeared (with stable ids) in SCOP 1.55
  
• d2proc1 appears in SCOPe 2.04
  
• d2proc1 appears in SCOPe 2.06
  
• d2proc1 appears in the current release, SCOPe 2.08