Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) automatically mapped to Pfam PF02983 |
Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein) |
Protein Alpha-lytic protease prodomain [54808] (1 species) duplication: consists of two domains of this fold |
Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries) |
Domain d2proc1: 2pro C:18-85 [38824] |
PDB Entry: 2pro (more details), 3 Å
SCOPe Domain Sequences for d2proc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2proc1 d.52.1.1 (C:18-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]} ifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklvaatsgarksstlg gvevrnvr
Timeline for d2proc1:
View in 3D Domains from other chains: (mouse over for more information) d2proa1, d2proa2, d2prob1, d2prob2 |