SCOPe 2.08: Domain d6sjjx_: 6sjj X:

Lineage for d6sjjx_ (6sjj X:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Hypericum perforatum [TaxId:65561] [189103] (4 PDB entries)

8. Domain d6sjjx_: 6sjj X: [388221]
   Other proteins in same PDB: d6sjjc2, d6sjje2, d6sjjg2, d6sjjh2, d6sjji2, d6sjjj2, d6sjjk2, d6sjjl2, d6sjjm2, d6sjjn2, d6sjjo2, d6sjjq2, d6sjjr2, d6sjjs2, d6sjjt2
   automated match to d5mmua_
   complexed with 2an, dms, epe, flc, so4

Details for d6sjjx_

PDB Entry: 6sjj, 2.3 Å

PDB Description: a new modulated crystal structure of ans complex of st john's wort hyp-1 protein with 36 protein molecules in the asymmetric unit of the supercell

PDB Compounds: (X:) PR-10 protein

SCOPe Domain Sequences for d6sjjx_:

Sequence; same for both SEQRES and ATOM records:

>d6sjjx_ d.129.3.0 (X:) automated matches {Hypericum perforatum [TaxId: 65561]}
maaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitfv
dghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvty
hpkpgctvneeevkigekkayefykqveeylaanpevfa

Timeline for d6sjjx_:

• d6sjjx_ first appeared in SCOPe 2.07