Lineage for d2proa2 (2pro A:86-158)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904630Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1904631Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
    automatically mapped to Pfam PF02983
  5. 1904632Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 1904633Protein Alpha-lytic protease prodomain [54808] (1 species)
    duplication: consists of two domains of this fold
  7. 1904634Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 1904644Domain d2proa2: 2pro A:86-158 [38821]

Details for d2proa2

PDB Entry: 2pro (more details), 3 Å

PDB Description: pro region of alpha-lytic protease
PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d2proa2:

Sequence, based on SEQRES records: (download)

>d2proa2 d.52.1.1 (A:86-158) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvries

Sequence, based on observed residues (ATOM records): (download)

>d2proa2 d.52.1.1 (A:86-158) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
yslkqlqsameqldagagvqswyvdprsnavvvkvddgatdagvdfvalsgadsaqvrie
s

SCOPe Domain Coordinates for d2proa2:

Click to download the PDB-style file with coordinates for d2proa2.
(The format of our PDB-style files is described here.)

Timeline for d2proa2: