| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) ![]() automatically mapped to Pfam PF02983 |
| Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein) |
| Protein Alpha-lytic protease prodomain [54808] (1 species) duplication: consists of two domains of this fold |
| Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries) |
| Domain d4proc2: 4pro C:86-166 [38817] Other proteins in same PDB: d4proa_, d4prob_ |
PDB Entry: 4pro (more details), 2.4 Å
SCOPe Domain Sequences for d4proc2:
Sequence, based on SEQRES records: (download)
>d4proc2 d.52.1.1 (C:86-166) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvriesspgklqtt
>d4proc2 d.52.1.1 (C:86-166) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
yslkqlqsameqldaganapldgvqswyvdprsnavvvkvddgatdagvdfvalsgadsa
qvriesspgklqtt
Timeline for d4proc2:
View in 3DDomains from other chains: (mouse over for more information) d4proa_, d4prob_, d4prod1, d4prod2 |