SCOPe 2.07: Domain d6oqwh2: 6oqw H:87-138

Lineage for d6oqwh2 (6oqw H:87-138)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (2 families)

5. Family a.2.10.0: automated matches [272493] (1 protein)
   not a true family

6. Protein automated matches [272494] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:991919] [388164] (1 PDB entry)

8. Domain d6oqwh2: 6oqw H:87-138 [388165]
   Other proteins in same PDB: d6oqwd1, d6oqwd2, d6oqwd3, d6oqwe1, d6oqwe2, d6oqwe3, d6oqwf1, d6oqwf2, d6oqwf3, d6oqwg_, d6oqwh1, d6oqwi_, d6oqwj_, d6oqwl_, d6oqwm_, d6oqwn_, d6oqwo_, d6oqwp_, d6oqwq_, d6oqwr_, d6oqws_
   automated match to d1bsna1
   complexed with adp, atp, mg, po4

Details for d6oqwh2

PDB Entry: 6oqw, 3.1 Å

PDB Description: e. coli atp synthase state 3a

PDB Compounds: (H:) ATP synthase epsilon chain

SCOPe Domain Sequences for d6oqwh2:

Sequence; same for both SEQRES and ATOM records:

>d6oqwh2 a.2.10.0 (H:87-138) automated matches {Escherichia coli [TaxId: 991919]}
qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvieltkkam

Timeline for d6oqwh2:

• d6oqwh2 is new in SCOPe 2.07-stable
  
• d6oqwh2 appears in the current release, SCOPe 2.08