SCOPe 2.07: Domain d6oqwf3: 6oqw F:344-459

Lineage for d6oqwf3 (6oqw F:344-459)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Escherichia coli [TaxId:741093] [388152] (1 PDB entry)

8. Domain d6oqwf3: 6oqw F:344-459 [388160]
   Other proteins in same PDB: d6oqwd1, d6oqwd2, d6oqwe1, d6oqwe2, d6oqwf1, d6oqwf2, d6oqwg_, d6oqwh1, d6oqwh2, d6oqwi_, d6oqwj_, d6oqwl_, d6oqwm_, d6oqwn_, d6oqwo_, d6oqwp_, d6oqwq_, d6oqwr_, d6oqws_
   automated match to d4q4la3
   complexed with adp, atp, mg, po4

Details for d6oqwf3

PDB Entry: 6oqw, 3.1 Å

PDB Description: e. coli atp synthase state 3a

PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d6oqwf3:

Sequence; same for both SEQRES and ATOM records:

>d6oqwf3 a.69.1.0 (F:344-459) automated matches {Escherichia coli [TaxId: 741093]}
ldplvvgqehydtargvqsilqryqelkdiiailgmdelseedklvvararkiqrflsqp
ffvaevftgspgkyvslkdtirgfkgimegeydhlpeqafymvgsieeavekakkl

Timeline for d6oqwf3:

• d6oqwf3 is new in SCOPe 2.07-stable
  
• d6oqwf3 appears in the current release, SCOPe 2.08