SCOP 1.65: Domain d3prod2: 3pro D:86-163

Lineage for d3prod2 (3pro D:86-163)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family)

5. Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)

6. Protein Alpha-lytic protease prodomain [54808] (1 species)
   duplication: consists of two domains of this fold

7. Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)

8. Domain d3prod2: 3pro D:86-163 [38815]
   Other proteins in same PDB: d3proa_, d3prob_
   complexed with 2ab; mutant

Details for d3prod2

PDB Entry: 3pro, 1.8 Å

PDB Description: alpha-lytic protease complexed with c-terminal truncated pro region

SCOP Domain Sequences for d3prod2:

Sequence, based on SEQRES records:

>d3prod2 d.52.1.1 (D:86-163) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvriesspgkl

Sequence, based on observed residues (ATOM records):

>d3prod2 d.52.1.1 (D:86-163) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganldgvqswyvdprsnavvvkvddgatdagvdfvalsgadsaqv
riesspgkl

Timeline for d3prod2:

• d3prod2 first appeared (with stable ids) in SCOP 1.55
  
• d3prod2 appears in SCOP 1.63
  
• d3prod2 appears in SCOP 1.67
  
• d3prod2 appears in the current release, SCOPe 2.08