Lineage for d6oqre2 (6oqr E:75-343)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2479937Species Escherichia coli [TaxId:562] [226067] (7 PDB entries)
  8. 2479954Domain d6oqre2: 6oqr E:75-343 [388136]
    Other proteins in same PDB: d6oqrd1, d6oqrd3, d6oqre1, d6oqre3, d6oqrf1, d6oqrf3, d6oqrg_, d6oqrh1, d6oqrh2, d6oqri_, d6oqrj_, d6oqrl_, d6oqrm_, d6oqrn_, d6oqro_, d6oqrp_, d6oqrq_, d6oqrr_, d6oqrs_
    automated match to d4q4la2
    complexed with adp, atp, mg, po4

Details for d6oqre2

PDB Entry: 6oqr (more details), 3.1 Å

PDB Description: e. coli atp synthase adp state 1a
PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d6oqre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oqre2 c.37.1.0 (E:75-343) automated matches {Escherichia coli [TaxId: 562]}
ievpvgkatlgrimnvlgepvdmkgeigeeerwaihraapsyeelsnsqelletgikvid
lmapfakggkvglfggagvgktvnmmelirniaiehsgysvfagvgertregndfyhemt
dsnvidkvslvygqmneppgnrlrvaltgltmaekfrdegrdvllfvdniyrytlagtev
sallgrmpsavgyqptlaeemgvlqeritstktgsitsvqavyvpaddltdpspattfah
ldatvvlsrqiaslgiypavdpldstsrq

SCOPe Domain Coordinates for d6oqre2:

Click to download the PDB-style file with coordinates for d6oqre2.
(The format of our PDB-style files is described here.)

Timeline for d6oqre2: