| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) ![]() automatically mapped to Pfam PF02983 |
| Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein) |
| Protein Alpha-lytic protease prodomain [54808] (1 species) duplication: consists of two domains of this fold |
| Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries) |
| Domain d3proc1: 3pro C:6-85 [38812] Other proteins in same PDB: d3proa_, d3prob_ complexed with aes |
PDB Entry: 3pro (more details), 1.8 Å
SCOPe Domain Sequences for d3proc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3proc1 d.52.1.1 (C:6-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
pqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklva
atsgarksstlggvevrnvr
Timeline for d3proc1:
View in 3DDomains from other chains: (mouse over for more information) d3proa_, d3prob_, d3prod1, d3prod2 |