Lineage for d3proc1 (3pro C:6-85)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904630Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1904631Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
    automatically mapped to Pfam PF02983
  5. 1904632Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 1904633Protein Alpha-lytic protease prodomain [54808] (1 species)
    duplication: consists of two domains of this fold
  7. 1904634Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 1904635Domain d3proc1: 3pro C:6-85 [38812]
    Other proteins in same PDB: d3proa_, d3prob_
    complexed with aes

Details for d3proc1

PDB Entry: 3pro (more details), 1.8 Å

PDB Description: alpha-lytic protease complexed with c-terminal truncated pro region
PDB Compounds: (C:) alpha-lytic protease

SCOPe Domain Sequences for d3proc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3proc1 d.52.1.1 (C:6-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
pqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklva
atsgarksstlggvevrnvr

SCOPe Domain Coordinates for d3proc1:

Click to download the PDB-style file with coordinates for d3proc1.
(The format of our PDB-style files is described here.)

Timeline for d3proc1: