SCOPe 2.01: Domain d1e3pa5: 1e3p A:579-634

Lineage for d1e3pa5 (1e3p A:579-634)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 [54803] (1 species)
   the type of KH-domain fold (II or I) adopted by this domain is not ascertained yet

7. Species Streptomyces antibioticus [TaxId:1890] [54804] (2 PDB entries)

8. Domain d1e3pa5: 1e3p A:579-634 [38811]
   Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa6, d1e3pa7
   partly disordered
   complexed with so4, wo4

Details for d1e3pa5

PDB Entry: 1e3p, 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme

PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOPe Domain Sequences for d1e3pa5:

Sequence, based on SEQRES records:

>d1e3pa5 d.52.3.1 (A:579-634) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
apriitvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaaea

Sequence, based on observed residues (ATOM records):

>d1e3pa5 d.52.3.1 (A:579-634) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
apriitvnqiqedtgaeiyigaadgpaaea

Timeline for d1e3pa5:

• d1e3pa5 first appeared (with stable ids) in SCOP 1.55
  
• d1e3pa5 appears in SCOP 1.75
  
• d1e3pa5 appears in SCOPe 2.02
  
• d1e3pa5 appears in the current release, SCOPe 2.08