| Root: SCOPe 2.01 |
| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
| Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
| Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 [54803] (1 species) the type of KH-domain fold (II or I) adopted by this domain is not ascertained yet |
| Species Streptomyces antibioticus [TaxId:1890] [54804] (2 PDB entries) |
| Domain d1e3pa5: 1e3p A:579-634 [38811] Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa6, d1e3pa7 partly disordered complexed with so4, wo4 |
PDB Entry: 1e3p (more details), 2.5 Å
SCOPe Domain Sequences for d1e3pa5:
Sequence, based on SEQRES records: (download)
>d1e3pa5 d.52.3.1 (A:579-634) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
apriitvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaaea
>d1e3pa5 d.52.3.1 (A:579-634) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
apriitvnqiqedtgaeiyigaadgpaaea
Timeline for d1e3pa5: