Lineage for d1e3pa5 (1e3p A:579-634)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32153Fold d.51: KH-domain [54790] (1 superfamily)
  4. 32154Superfamily d.51.1: KH-domain [54791] (1 family) (S)
  5. 32155Family d.51.1.1: KH-domain [54792] (6 proteins)
  6. 32173Protein Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 6 [54803] (1 species)
  7. 32174Species Streptomyces antibioticus [TaxId:1890] [54804] (2 PDB entries)
  8. 32176Domain d1e3pa5: 1e3p A:579-634 [38811]
    Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa6, d1e3pa7

Details for d1e3pa5

PDB Entry: 1e3p (more details), 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3pa5:

Sequence, based on SEQRES records: (download)

>d1e3pa5 d.51.1.1 (A:579-634) Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus}
apriitvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaaea

Sequence, based on observed residues (ATOM records): (download)

>d1e3pa5 d.51.1.1 (A:579-634) Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus}
apriitvnqiqedtgaeiyigaadgpaaea

SCOP Domain Coordinates for d1e3pa5:

Click to download the PDB-style file with coordinates for d1e3pa5.
(The format of our PDB-style files is described here.)

Timeline for d1e3pa5: