Lineage for d6vr5d1 (6vr5 D:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545171Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2545227Domain d6vr5d1: 6vr5 D:1-181 [388102]
    Other proteins in same PDB: d6vr5a2, d6vr5b1, d6vr5b2, d6vr5d2, d6vr5e1, d6vr5e2
    automated match to d1fo0h2

Details for d6vr5d1

PDB Entry: 6vr5 (more details), 2.38 Å

PDB Description: complex of hla-a2, a class i mhc, with a p53 peptide
PDB Compounds: (D:) MHC class I antigen

SCOPe Domain Sequences for d6vr5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vr5d1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d6vr5d1:

Click to download the PDB-style file with coordinates for d6vr5d1.
(The format of our PDB-style files is described here.)

Timeline for d6vr5d1: