Lineage for d6y5ta_ (6y5t A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873525Protein Subtilisin [52745] (7 species)
  7. 2873595Species Bacillus lentus, savinase (TM) [TaxId:1467] [52749] (8 PDB entries)
    Uniprot P29600
  8. 2873599Domain d6y5ta_: 6y5t A: [388092]
    automated match to d1svna_
    complexed with ca, na

Details for d6y5ta_

PDB Entry: 6y5t (more details), 1.1 Å

PDB Description: crystal structure of savinase at room temperature
PDB Compounds: (A:) Subtilisin Savinase

SCOPe Domain Sequences for d6y5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y5ta_ c.41.1.1 (A:) Subtilisin {Bacillus lentus, savinase (TM) [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d6y5ta_:

Click to download the PDB-style file with coordinates for d6y5ta_.
(The format of our PDB-style files is described here.)

Timeline for d6y5ta_: