Lineage for d1khma_ (1khm A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328412Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 328413Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 328414Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (7 proteins)
    an RNA-binding domain
  6. 328422Protein HnRNP K, KH3 [54801] (1 species)
  7. 328423Species Human (Homo sapiens) [TaxId:9606] [54802] (2 PDB entries)
  8. 328424Domain d1khma_: 1khm A: [38809]

Details for d1khma_

PDB Entry: 1khm (more details)

PDB Description: c-terminal kh domain of hnrnp k (kh3)

SCOP Domain Sequences for d1khma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khma_ d.51.1.1 (A:) HnRNP K, KH3 {Human (Homo sapiens)}
gspnsygdlggpiittqvtipkdlarsiigkggqrikqirhesgasikideplegsedri
ititgtqdqiqnaqyllqnsvkqysgkff

SCOP Domain Coordinates for d1khma_:

Click to download the PDB-style file with coordinates for d1khma_.
(The format of our PDB-style files is described here.)

Timeline for d1khma_: