Lineage for d1khma_ (1khm A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.51: Eukaryotic type KH-domain (eKH-domain) [54790] (1 superfamily) Superfamily d.51.1: Eukaryotic type KH-domain (eKH-domain) [54791] (1 family) 
Family d.51.1.1: Eukaryotic type KH-domain (eKH-domain) [54792] (7 proteins) 
Protein HnRNP K, KH3 [54801] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54802] (2 PDB entries) 
Domain d1khma_: 1khm A: [38809]
Details for d1khma_
PDB Entry: 1khm (more details)
PDB Description: c-terminal kh domain of hnrnp k (kh3)
SCOP Domain Sequences for d1khma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khma_ d.51.1.1 (A:) HnRNP K, KH3 {Human (Homo sapiens)}
gspnsygdlggpiittqvtipkdlarsiigkggqrikqirhesgasikideplegsedri
ititgtqdqiqnaqyllqnsvkqysgkff
SCOP Domain Coordinates for d1khma_:
Click to download the PDB-style file with coordinates for d1khma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1khma_:
- d1khma_ first appeared (with stable ids) in SCOP 1.55
- d1khma_ appears in SCOP 1.59
- d1khma_ appears in SCOP 1.63
- d1khma_ appears in the current release, SCOPe 2.08
View in 3D