Lineage for d6xa9f_ (6xa9 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933295Domain d6xa9f_: 6xa9 F: [388085]
    Other proteins in same PDB: d6xa9a2, d6xa9c2, d6xa9e2
    automated match to d5tl6c_
    complexed with gol, zn

Details for d6xa9f_

PDB Entry: 6xa9 (more details), 2.9 Å

PDB Description: sars cov-2 plpro in complex with isg15 c-terminal domain propargylamide
PDB Compounds: (F:) ISG15 CTD-propargylamide

SCOPe Domain Sequences for d6xa9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xa9f_ d.15.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
eyglkplstvfmnlrlrgx

SCOPe Domain Coordinates for d6xa9f_:

Click to download the PDB-style file with coordinates for d6xa9f_.
(The format of our PDB-style files is described here.)

Timeline for d6xa9f_: