Lineage for d2fmr__ (2fmr -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503404Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 503405Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 503406Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (8 proteins)
    an RNA-binding domain
  6. 503411Protein Fragile X protein, KH1 [54799] (1 species)
  7. 503412Species Human (Homo sapiens) [TaxId:9606] [54800] (1 PDB entry)
  8. 503413Domain d2fmr__: 2fmr - [38808]

Details for d2fmr__

PDB Entry: 2fmr (more details)

PDB Description: kh1 from the fragile x protein fmr1, nmr, 18 structures

SCOP Domain Sequences for d2fmr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmr__ d.51.1.1 (-) Fragile X protein, KH1 {Human (Homo sapiens)}
asrfheqfivredlmglaigthganiqqarkvpgvtaidldedtctfhiygedqdavkka
rsfle

SCOP Domain Coordinates for d2fmr__:

Click to download the PDB-style file with coordinates for d2fmr__.
(The format of our PDB-style files is described here.)

Timeline for d2fmr__: