SCOPe 2.07: Domain d6vrmd1: 6vrm D:2-111

Lineage for d6vrmd1 (6vrm D:2-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6vrmd1: 6vrm D:2-111 [388072]
   Other proteins in same PDB: d6vrma1, d6vrmb1, d6vrmb2, d6vrmd2
   automated match to d2pyfa1

Details for d6vrmd1

PDB Entry: 6vrm, 2.61 Å

PDB Description: t cell receptor-p53-hla-a2 complex

PDB Compounds: (D:) T-cell receptor 12-6, alfa chain

SCOPe Domain Sequences for d6vrmd1:

Sequence; same for both SEQRES and ATOM records:

>d6vrmd1 b.1.1.0 (D:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqdpgpfnvpegatvafnctysnsasqsffwyrqdcrkepkllmsvyssgnedgrft
aqlnrasqyisllirdsklsdsatylcvvqpggyqkvtfgtgtklqvipn

Timeline for d6vrmd1:

• d6vrmd1 is new in SCOPe 2.07-stable
  
• d6vrmd1 appears in the current release, SCOPe 2.08