Lineage for d1viha_ (1vih A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904496Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1904497Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1904498Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 1904579Protein Vigilin [54797] (1 species)
  7. 1904580Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries)
  8. 1904587Domain d1viha_: 1vih A: [38807]

Details for d1viha_

PDB Entry: 1vih (more details)

PDB Description: nmr study of vigilin, repeat 6, minimized average structure
PDB Compounds: (A:) Vigilin

SCOPe Domain Sequences for d1viha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1viha_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
qakrellelas

SCOPe Domain Coordinates for d1viha_:

Click to download the PDB-style file with coordinates for d1viha_.
(The format of our PDB-style files is described here.)

Timeline for d1viha_: