Lineage for d1vih__ (1vih -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79774Fold d.51: KH-domain [54790] (1 superfamily)
  4. 79775Superfamily d.51.1: KH-domain [54791] (1 family) (S)
  5. 79776Family d.51.1.1: KH-domain [54792] (6 proteins)
  6. 79798Protein Vigilin, KH6 [54797] (1 species)
  7. 79799Species Human (Homo sapiens) [TaxId:9606] [54798] (2 PDB entries)
  8. 79801Domain d1vih__: 1vih - [38807]

Details for d1vih__

PDB Entry: 1vih (more details)

PDB Description: nmr study of vigilin, repeat 6, minimized average structure

SCOP Domain Sequences for d1vih__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vih__ d.51.1.1 (-) Vigilin, KH6 {Human (Homo sapiens)}
inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
qakrellelas

SCOP Domain Coordinates for d1vih__:

Click to download the PDB-style file with coordinates for d1vih__.
(The format of our PDB-style files is described here.)

Timeline for d1vih__: