Lineage for d1viga_ (1vig A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2514683Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2514684Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2514685Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 protein domains)
    an RNA-binding domain
  6. 2514766Protein Vigilin [54797] (1 species)
  7. 2514767Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries)
  8. 2514775Domain d1viga_: 1vig A: [38806]

Details for d1viga_

PDB Entry: 1vig (more details)

PDB Description: nmr study of vigilin, repeat 6, 40 structures
PDB Compounds: (A:) Vigilin

SCOPe Domain Sequences for d1viga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
qakrellelas

SCOPe Domain Coordinates for d1viga_:

Click to download the PDB-style file with coordinates for d1viga_.
(The format of our PDB-style files is described here.)

Timeline for d1viga_: