SCOPe 2.07: Domain d1ec6b1: 1ec6 B:5-87

Lineage for d1ec6b1 (1ec6 B:5-87)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
   an RNA-binding domain

6. Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries)

8. Domain d1ec6b1: 1ec6 B:5-87 [38805]
   Other proteins in same PDB: d1ec6a2, d1ec6b2
   protein/RNA complex

Details for d1ec6b1

PDB Entry: 1ec6, 2.4 Å

PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain bound to 20-mer rna hairpin

PDB Compounds: (B:) RNA-binding protein nova-2

SCOPe Domain Sequences for d1ec6b1:

Sequence; same for both SEQRES and ATOM records:

>d1ec6b1 d.51.1.1 (B:5-87) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]}
kelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspaa
tqaaqylisqrvtyeqgvrasnp

Timeline for d1ec6b1:

• d1ec6b1 first appeared (with stable ids) in SCOP 1.55, called d1ec6b_
  
• d1ec6b1 appears in SCOPe 2.06
  
• d1ec6b1 appears in the current release, SCOPe 2.08